• Species Reactivity

  Human

• Specificity

  Detects human Osteocalcin in direct ELISAs.

• Source

  Monoclonal Mouse IgG    ₁ Clone # 190125

• Purification

  Protein A or G purified from hybridoma culture supernatant

• Immunogen

  Human Osteocalcin synthetic peptide    
  YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV    
  Accession # P02818

• Formulation

  Supplied in a saline solution containing BSA and Sodium Azide.

• Label

  Allophycocyanin

Applications

• 
  

  Recommended    
  Concentration

  Sample

• Intracellular Staining by Flow Cytometry

  10 µL/10    ⁶ cells

  See below

• 
  

Please Note: Optimal dilutions should be determined by each laboratory for each application.  are available in the Technical Information section on our website.

Data Examples

Preparation and Storage

• Shipping

  The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

• Stability & Storage

  Protect from light.    Do not freeze.    

• 12 months from date of receipt, 2 to 8 °C as supplied.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

• References:

1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

• Long Name:

  Bone gamma-Carboxyglutamate [gla] Protein

• Entrez Gene IDs:

  632 (Human); 12096 (Mouse); 25295 (Rat)

• Alternate Names:

  BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin